Search results for "critical infrastructure"

showing 10 items of 20 documents

The Development of Resilience Management Guidelines to Protect Critical Infrastructures in Europe

2018

The capability to be resilient in the face of crises and disasters is a topic of highest political concern in Europe especially as far as critical infrastructures and urban environments are concerned. Critical infrastructures are systems or part of systems essential for the maintenance of vital societal functions, the disruption or destruction of which would have a significant impact on the well-being of people. Examples of them are transportation services, energy infrastructures, water and wastewater systems, health and emergency services, financial services, communication infrastructures, etc. The symposium focuses on the experience of four different projects funded under the Horizon 2020…

Community resilienceResilience engineeringbusiness.industry0207 environmental engineering02 engineering and technology010501 environmental sciences01 natural sciencesCritical infrastructureCritical infrastructurePolitics13. Climate actionDarwin (ADL)Urban resilience11. SustainabilityResilience engineeringBusiness020701 environmental engineeringUrban resilienceResilience (network)Environmental planningFinancial services0105 earth and related environmental sciences
researchProduct

Cyber Situational Awareness in Critical Infrastructure Organizations

2021

The capability related to cybersecurity plays an ever-growing role on overall national security and securing the functions vital to society. The national cyber capability is mainly composed by resilience of companies running critical infrastructures and their cyber situational awareness (CSA). According to a common view, components of critical infrastructures become more complex and interdependent on each other and, as a consequence, ramifications of incidents multiply. In practice, the actions relate to developing better CSA and understanding of a critical infrastructure organization. The aim is to prepare for incidents and their management in a whole-of-society approach. The arrangement i…

Process managementNational securitySituation awarenessOperating modelcybersecurityProcess (engineering)business.industryturvallisuusympäristömedia_common.quotation_subjectInformation sharingtilannekuvaCritical infrastructureInterdependencesituational awarenesscritical infrastructureinformation sharingvital societal functionsBusinessinfrastruktuuritkansallinen turvallisuusResilience (network)kyberturvallisuusmedia_common
researchProduct

Terveydenhuolto ja kyberuhkat

2019

Kyberturvallisuusstrategian vision mukaan Suomen tulee kyetä suojaamaan elintärkeät toimintonsa kyberuhkaa vastaan kaikissa tilanteissa. Terveydenhuolto on yksi elintärkeistä toiminnoista. Terveystoimiala on kyberhyökkäysten top-5-listalla ensimmäisenä. Hyökkäysten keskeisin motivaatio on potilastietojen arvo pimeillä markkinoilla. Vuonna 2015 varastettiin yli satamiljoonaa potilastietoa, jotka sisältävät rikollisille arvokkaita tietoja, kuten luottokorttinumeroita, työnantajatietoja ja sairaushistoriatietoja. Tässä artikkelissa kuvataan terveydenhuoltoon liittyviä kyberuhkia, kyberhaavoittuvuuksia ja toteutuneita kyberhyökkäyksiä kybermaailman eri ulottuvuudet kattaen. Tarkastelussa käytet…

health care [http://www.yso.fi/onto/yso/p2641]kyberturvallisuus [http://www.yso.fi/onto/yso/p26189]cyber threatcritical infrastructurekyberuhkaterveydenhuoltoterveydenhoitocyber security [http://www.yso.fi/onto/yso/p26189]kyberturvallisuusMuut artikkelit / Other articleskriittinen infrastruktuuriterveydenhuolto [http://www.yso.fi/onto/yso/p2658]Finnish Journal of eHealth and eWelfare
researchProduct

Towards a resilience management guideline — Cities as a starting point for societal resilience

2019

Unexpected crises and risks affect the urban population. Critical infrastructure dependency, climate change and social dynamics have captured the attention of city decision makers across different disciplines, sectors, and scales. Addressing these challenges mandates an increase in resilience. This article presents the development of the novel European Resilience Management Guideline (ERMG) developed by the European H2020 Smart Mature Resilience (SMR) project. It encompasses five supporting tools for city resilience. The purpose of this article is threefold. First, it describes the extensive co-creation methods used to establish, validate and test the five ERMG tools as collaborations among…

education.field_of_studyProcess managementOperationalizationRenewable Energy Sustainability and the Environmentbusiness.industryGeography Planning and DevelopmentPopulation0211 other engineering and technologiesTransportation02 engineering and technology010501 environmental sciences01 natural sciencesCritical infrastructureSocial dynamicsHD61Strategic management021108 energyBusinessResilience (network)educationUrban resilienceRisk management0105 earth and related environmental sciencesCivil and Structural EngineeringSustainable Cities and Society
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct

Emergent vulnerabilities in Integrated Operations: A proactive simulation study of economic risk

2009

Abstract The protection of critical infrastructure requires an understanding of the effects of change on current and future safety and operations. Vulnerabilities may emerge during the rollout of updated techniques and integration of new technology with existing work practices. Managers need to understand how their decisions, often focused on economic priorities, affect the dynamics of vulnerability over time. Such understanding is difficult to obtain, as the historical data typically used for decision support, prediction and forecasting may not be available. We report on the use of group model building and simulation to consider proactively the effects of a 10-year, multi-billion dollar mo…

Decision support systemInformation Systems and ManagementTechnological changeManagement scienceComputer scienceProcess (engineering)VulnerabilityIntegrated operationsCritical infrastructureComputer Science ApplicationsRisk analysis (engineering)Vulnerability assessmentModeling and SimulationProblem domainSafety Risk Reliability and QualityInternational Journal of Critical Infrastructure Protection
researchProduct

Health care and cyber threats

2019

ta113critical infrastructurecyber threatkyberuhkaterveydenhuoltocyber securitykyberturvallisuushealth carekriittinen infrastruktuuriFinnish Journal of eHealth and eWelfare
researchProduct

Phenomena in the Cyber World

2015

This chapter describes and evaluates the cyber world, including its phenomena, from a strategic perspective. As no universally accepted definitions for the cyber world exist, associated literature and publications address it in many different ways. A five-layer model is constructed for cyber threats, which include cybervandalism, cybercrime, cyber intelligence, cyberterrorism and cyberwarfare. This chapter depicts the standards-based risk model, cyber operations and cyberweaponry, as well as the critical structures of society as the targets. Moreover, cyber security definitions are provided. Cyber world phenomena are addressed in more detail in other chapters of this book.

CybercrimeRisk modelCyberwarfareComputer scienceCyberterrorismPerspective (graphical)Network-centric warfareComputer securitycomputer.software_genrecomputerComputingMilieux_MISCELLANEOUSInformation warfareCritical infrastructure
researchProduct

Cyber Situational Awareness in Critical Infrastructure Protection

2020

The European Union promotes collaboration between authorities and the private sector, and the providers of the most critical services to society face security related obligations. In this paper, critical infrastructure is seen as a system of systems that can be subject to cyber-attacks and other disturbances. Situational awareness (SA) enhances preparations for and decision-making during assessed and unforeseen disruptive incidents, and promoting Cyber effective situational awareness (CSA) requires information sharing between the different interest groups. This research is constructive in nature, where innovative constructions developed as solutions for domain-specific real world problem…

System of systemsSituation awarenessbusiness.industryInternet privacyCritical infrastructure protectionOcean EngineeringCritical infrastructureOODA loopmedia_common.cataloged_instanceBusinessEuropean unionSituational ethicsResilience (network)media_commonAnnals of Disaster Risk Sciences
researchProduct

Effects of cyber domain in crisis management

2019

There is fundamental need in EU-level to develop common alarm procedures and emergency response models with preventive functions which work well from local to national level and from national to international level. European Public Protection and Disaster Relief (PPDR) services such as law enforcement, firefighting, emergency medical and disaster recovery services have recognized that lack of interoperability of technical systems limits cooperation between the PPDR authorities. Also, the military (MIL) and critical infrastructure protection (CIP) faces similar challenges. Recent major accidents have indicated that lack of human resources affects to disaster recovery. PPDR-actors cannot star…

PPDRpelastustoimiemergency responsecritical infrastructure protectionpelastustoimintainfrastruktuurittoimintamallitkyberturvallisuushätätilanteetcontinuity managementcyber-physical threats
researchProduct